PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004500457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 265aa    MW: 29784.8 Da    PI: 5.6919
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004500457.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.66.6e-181152344
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    i n+ +r  tf kR+ng+lKK  EL+vLC++e++ ii++++ 
  XP_004500457.1 11 IINQARRRATFKKRKNGLLKKIGELCVLCGIEACTIIYGENE 52
                    779************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.381151IPR002100Transcription factor, MADS-box
CDDcd002669.31E-30285No hitNo description
SuperFamilySSF554552.88E-23394IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MARRRVKLAY IINQARRRAT FKKRKNGLLK KIGELCVLCG IEACTIIYGE NEQEAEVWPS  60
TPGTRRVLAR FMSLPELERR KNMLDLEGFL TKSIAKTQEA CRKQMEENKK KEMSILISQF  120
IHTGEYNLGA NANLKDLNDL TELIDNNLKD VEQRIASMDL EVEQETGYRT EPMNAGVQGL  180
ETNMNHAGVQ GLETGMNNAD VQGLETNINH VGVQGPETSM NNAGVQGSET SMNHAMPTHG  240
EHWPIDFPML PFSDANMDTN GFWSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRRVKLAYIINQARRRATFKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004500457.10.0PREDICTED: agamous-like MADS-box protein AGL80
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1816226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-37AGAMOUS-like 80